PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P20950_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 236aa    MW: 27412.7 Da    PI: 6.874
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P20950_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.9e-2068121356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++++eq+++Le+ Fe+ ++++a+++ eLA+ lgL+ rqV vWFqNrRa++k
  GSMUA_Achr7P20950_001  68 KKRRLNSEQVRTLERNFEMGNKLDADRKMELARALGLQPRQVAVWFQNRRARWK 121
                            45689************************************************9 PP

2HD-ZIP_I/II117.95.8e-3867157191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl++eqv++LE++Fe+ +kL+ +rK+elar+LglqprqvavWFqnrRAR+k kqlEkd++ Lkr+++ +k+ene+L++ +++L 
  GSMUA_Achr7P20950_001  67 EKKRRLNSEQVRTLERNFEMGNKLDADRKMELARALGLQPRQVAVWFQNRRARWKIKQLEKDHDELKRQLEIMKTENEALQARNKKLL 154
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                            +el
  GSMUA_Achr7P20950_001 155 SEL 157
                            887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.89E-2059124IPR009057Homeodomain-like
PROSITE profilePS5007117.16763123IPR001356Homeobox domain
SMARTSM003891.2E-1966127IPR001356Homeobox domain
PfamPF000464.2E-1768121IPR001356Homeobox domain
CDDcd000862.60E-1568124No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2074121IPR009057Homeodomain-like
PRINTSPR000312.6E-694103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000312.6E-6103119IPR000047Helix-turn-helix motif
PfamPF021832.9E-7123163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MACNRMPLFF PANLVLQTAH EENHQQQLHT STCGMGNRSI PFSRVEACEE MNVEEDLSDD  60
ALQPGGEKKR RLNSEQVRTL ERNFEMGNKL DADRKMELAR ALGLQPRQVA VWFQNRRARW  120
KIKQLEKDHD ELKRQLEIMK TENEALQARN KKLLSELLAL KDREPSEPIN LNKETEGSSS  180
SDTDLDFSRR RPSSVSQPRR SSKSETAKNE GFCNMFCNTD EQSALWAWSE QHNYHH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARWKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009410378.11e-171PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X1
SwissprotQ8LC033e-71ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLM0TJD21e-176M0TJD2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P20950_0011e-176(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26960.17e-68homeobox protein 23